PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009631913.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 266aa    MW: 30737.9 Da    PI: 4.8125
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009631913.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM78.12e-2441264128
             NAM   4 GfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                       +F+P+d +l+++ L k v+gk l++ee i  +d+y+ ePw+L   +++ +k  yf ++ +kk++t+ r nr+t +g+W ++ k k++l++ ++
  XP_009631913.1   4 SAKFRPSDTDLIMQ-LLKFVAGKCLPTEELIVFADVYSKEPWQLIGDMNS-KKTHYFLTQLKKKKPTDARFNRTTGNGTWTQQNKGKKILDEdDS 96 
                     579*********77.667899999999999**************866654.577899999*******************************8556 PP

             NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                       +g k++L++   ++ ++ + +W+m ey l
  XP_009631913.1  97 LIIGYKRSLTYK-HKKDSSLNGRWLMMEYFL 126
                     669*******98.5666669*********76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100527.5721150IPR003441NAC domain
PfamPF023652.2E-115125IPR003441NAC domain
SuperFamilySSF1019412.22E-246149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MEKSAKFRPS DTDLIMQLLK FVAGKCLPTE ELIVFADVYS KEPWQLIGDM NSKKTHYFLT  60
QLKKKKPTDA RFNRTTGNGT WTQQNKGKKI LDEDDSLIIG YKRSLTYKHK KDSSLNGRWL  120
MMEYFLADYL LQELKSDEAK EFVICAIKKN PRSEIRGNGI ATIVEYKRFI DRVLQEGVHL  180
QTPSEQSTMI LSKLESTSSD VFSMGQLESK DGMLVIINQT DSDEFFVMVN VENQECYYQE  240
GDEEEVDWES ILDFGDHGSV QNDLLY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU7532640.0EU753264.1 Nicotiana tabacum NAC transcription factor (NAC7) mRNA, complete cds.
GenBankEU7532650.0EU753265.1 Nicotiana tabacum NAC transcription factor (NAC8) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009631915.10.0PREDICTED: transcription factor JUNGBRUNNEN 1-like
RefseqXP_009631914.10.0PREDICTED: transcription factor JUNGBRUNNEN 1-like
RefseqXP_009631913.10.0PREDICTED: transcription factor JUNGBRUNNEN 1-like
RefseqXP_009631912.10.0PREDICTED: transcription factor JUNGBRUNNEN 1-like
TrEMBLB3VK761e-171B3VK76_TOBAC; NAC transcription factor
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.12e-15NAC domain containing protein 83